PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400002597
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family WRKY
Protein Properties Length: 76aa    MW: 8800.06 Da    PI: 9.758
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400002597genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY63.34.1e-2020592059
                          S-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                  WRKY 20 fprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59
                            rsYYrCt++gC+v+k+ver+++dpk+v++tY g+Hnh+
  PGSC0003DMP400002597 20 IYRSYYRCTYPGCNVRKQVERASTDPKAVITTYDGKHNHD 59
                          56*************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1182901.7E-161861IPR003657WRKY domain
SMARTSM007741.0E-111860IPR003657WRKY domain
Gene3DG3DSA:2.20.25.804.8E-192061IPR003657WRKY domain
PfamPF031066.6E-152059IPR003657WRKY domain
PROSITE profilePS5081121.5282261IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 76 aa     Download sequence    Send to blast
MCPVVLLDDM NNPLMHLNLI YRSYYRCTYP GCNVRKQVER ASTDPKAVIT TYDGKHNHDI  60
PTVRNRGTRN KYSQR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A7e-204621478Probable WRKY transcription factor 4
2lex_A7e-204621478Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754414e-88HG975441.1 Solanum pennellii chromosome ch02, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001305593.11e-31probable WRKY transcription factor 3
SwissprotQ9XI903e-18WRKY4_ARATH; Probable WRKY transcription factor 4
TrEMBLM0ZM192e-50M0ZM19_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000036375e-31(Solanum tuberosum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G13960.23e-20WRKY DNA-binding protein 4
Publications ? help Back to Top
  1. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]